Novus Biologicals
Manufacturer Code:NBP156406
Catalog # NBP156406
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACTR3(ARP3 actin-related protein 3 homolog (yeast)) Antibody(against the N terminal of ACTR3 (NP_005712). Peptide sequence IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Actin-like protein 3; Actin-related protein 3; actin-related protein 3 ARP3 (actin-related protein 3 yeast) homolog ARP3 actin-related protein 3 homolog (yeast) ARP3Actin-like protein 3; ARP3 actin-related protein 3 homolog
Gene Aliases: ACTR3; ARP3
UniProt ID: (Human) P61158
Entrez Gene ID: (Human) 10096
Molecular Function:
actin and actin related protein
actin family cytoskeletal protein
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.