Novus Biologicals
Manufacturer Code:NBP15320120UL
Catalog # NBP1532020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACTR2(ARP2 actin-related protein 2 homolog (yeast)) The peptide sequence was selected from the N terminal of ACTR2. Peptide sequence NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Actin-like protein 2; Actin-related protein 2; actin-related protein 2 ARP2 (actin-related protein 2 yeast) homolog ARP2 actin-related protein 2 homolog (yeast) ARP2Actin-like protein 2; ARP2 actin-related protein 2 homolog
Gene Aliases: ACTR2; ARP2
UniProt ID: (Human) P61160
Entrez Gene ID: (Human) 10097
Molecular Function:
actin and actin related protein
actin family cytoskeletal protein
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.