Novus Biologicals
Manufacturer Code:NBP15688620UL
Catalog # NBP15688620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACTR10(actin-related protein 10 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ACTR10 (NP_060947). Peptide sequence SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Actin-related protein 10; actin-related protein 10 homolog (S. cerevisiae) Actin-related protein 11 ACTR11actin-related protein 10 Arp11 HARP11; Actin-related protein 11; hARP11
Gene Aliases: ACTR10; ACTR11; Arp10; ARP11; HARP11
UniProt ID: (Human) Q9NZ32
Entrez Gene ID: (Human) 55860
Molecular Function: actin and actin related protein actin family cytoskeletal protein cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.