Novus Biologicals
Manufacturer Code:NBP230612
Catalog # NBP230612
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTVQHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFML |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACAS2L AceCS2 AceCS2L Acetate--CoA ligase 2 Acetyl-CoA synthetase 2 acetyl-Coenzyme A synthetase 2 (AMP forming)-like acetyl-coenzyme A synthetase 2-like mitochondrial acyl-CoA synthetase short-chain family member 1dJ568C11.3 EC 6.2.1 EC 6.2.1.1 FLJ45659 KIAA1846 MGC33843; AceCS2; Acetate--CoA ligase 2; Acetyl-CoA synthetase 2; Acetyl-coenzyme A synthetase 2-like, mitochondrial; Acyl-CoA synthetase short-chain family member 1; Propionate--CoA ligase
Gene Aliases: ACAS2L; ACECS1; AceCS2L; ACSS1; KIAA1846
UniProt ID: (Human) Q5TF42
Entrez Gene ID: (Human) 84532
Molecular Function:
dehydrogenase
ligase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.