Novus Biologicals
Manufacturer Code:NBP174275
Catalog # NBP174275
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to thetase medium chain family member 3 Antibody against the N terminal of ACSM3. Immunizing peptide sequence SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyl-CoA synthetase medium-chain family member 3; acyl-CoA synthetase medium-chain family member 3Protein SA homolog acyl-coenzyme A synthetase ACSM3 mitochondrial Butyrate--CoA ligase 3 Butyryl-coenzyme A synthetase 3 EC 6.2.1 Middle-chain acyl-CoA synthetase 3 SA SA (rat hypertension-associated) homolog SA hypertension-associated homolog SA hypertension-associated homolog (rat) SAH SAHEC 6.2.1.2; Acyl-coenzyme A synthetase ACSM3, mitochondrial; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; Protein SA homolog; SA (rat hypertension-associated) homolog; SA hypertension-associated homolog
Gene Aliases: ACSM3; SA; SAH
UniProt ID: (Human) Q53FZ2
Entrez Gene ID: (Human) 6296
Molecular Function: dehydrogenase ligase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.