Novus Biologicals
Manufacturer Code:NBP258817
Catalog # NBP258817
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACS3EC 6.2.1.3 acyl-CoA synthetase long-chain family member 3 FACL3lignoceroyl-CoA synthase fatty-acid-Coenzyme A ligase long-chain 3 LACS 3 LACS3 Long-chain acyl-CoA synthetase 3 long-chain-fatty-acid--CoA ligase 3 PRO2194; Arachidonate--CoA ligase; fatty-acid-Coenzyme A ligase, long-chain 3; LACS 3; lignoceroyl-CoA synthase; Long-chain acyl-CoA synthetase 3; Long-chain-fatty-acid--CoA ligase 3
Gene Aliases: ACS3; ACSL3; FACL3; LACS3; PRO2194
UniProt ID: (Human) O95573
Entrez Gene ID: (Human) 2181
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.