Novus Biologicals
Manufacturer Code:NBP15496320UL
Catalog # NBP15496320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACSBG2(acyl-CoA synthetase bubblegum family member 2) The peptide sequence was selected from the middle region of ACSBG2. Peptide sequence LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyl-CoA synthetase bubblegum family member 2; acyl-CoA synthetase bubblegum family member 2BRGL BGRMGC111089 Bubblegum-related protein DKFZp434K1635 EC 6.2.1.3 long-chain-fatty-acid--CoA ligase ACSBG2 PRTD-NY3PRTDNY3; Arachidonate--CoA ligase ACSBG2; Bubblegum-related protein; Long-chain-fatty-acid--CoA ligase ACSBG2; PRTD-NY3; testicular tissue protein Li 8
Gene Aliases: ACSBG2; BGR; BRGL; PRTD-NY3; PRTDNY3; UNQ2443/PRO5005
UniProt ID: (Human) Q5FVE4
Entrez Gene ID: (Human) 81616
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.