Novus Biologicals
Manufacturer Code:NBP231990
Catalog # NBP231990
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acyl-CoA synthetase bubblegum family member 1; acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3 BG1 BGMBG bubblegum FLJ30320 hBG1 hsBG hsBGM KIAA0631GR-LACS lipidosin long-chain-fatty-acid--CoA ligase ACSBG1 LPD MGC14352 very long-chain acyl-CoA synthetase; bubblegum; hBG1; Lipidosin; Long-chain-fatty-acid--CoA ligase ACSBG1; very long-chain acyl-CoA synthetase
Gene Aliases: ACSBG1; BG; BG1; BGM; GR-LACS; KIAA0631; LPD
UniProt ID: (Human) Q96GR2
Entrez Gene ID: (Human) 23205
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.