Novus Biologicals
Manufacturer Code:NBP15487020UL
Catalog # NBP15487020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACP6(acid phosphatase 6 lysophosphatidic) The peptide sequence was selected from the N terminal of ACP6. Peptide sequence EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: acid phosphatase 6 lysophosphatidicPACPL1 Acid phosphatase-like protein 1 ACPL1acid phosphatase like 1 EC 3.1.3.2 LPAPlysophosphatidic acid phosphatase type 6; Acid phosphatase 6, lysophosphatidic; Acid phosphatase-like protein 1; Lysophosphatidic acid phosphatase type 6; PACPL1
Gene Aliases: ACP6; ACPL1; LPAP; PACPL1; UNQ205/PRO231
UniProt ID: (Human) Q9NPH0
Entrez Gene ID: (Human) 51205
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.