Novus Biologicals
Manufacturer Code:NBP190822
Catalog # NBP190822
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACK-1; ACK-1 ACK1ACKp21cdc42Hs activated CDC42 kinase 1 activated Cdc42-associated kinase 1 activated p21cdc42Hs kinase EC 2.7.10 EC 2.7.10.2 FLJ44758 FLJ45547 Tyrosine kinase non-receptor protein 2 tyrosine kinase non-receptor 2; Activated CDC42 kinase 1; activated Cdc42-associated kinase 1; activated p21cdc42Hs kinase; Tyrosine kinase non-receptor protein 2; tyrosine kinase, non-receptor, 2
Gene Aliases: ACK; ACK-1; ACK1; p21cdc42Hs; TNK2
UniProt ID: (Human) Q07912
Entrez Gene ID: (Human) 10188
Molecular Function:
kinase
non-receptor tyrosine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.