Novus Biologicals
Manufacturer Code:NBP190271
Catalog # NBP190271
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACF65 ACFASPACF64 apo-B RNA editing protein APOBEC1 complementation factor apobec-1 complementation factor (ACF) (ASP) APOBEC-1 stimulating protein APOBEC1CF APOBEC1-stimulating protein MGC163391; apo-B RNA editing protein; apobec-1 complementation factor (ACF) (ASP); APOBEC-1 stimulating protein; APOBEC1 complementation factor; APOBEC1-stimulating protein
Gene Aliases: A1CF; ACF; ACF64; ACF65; APOBEC1CF; ASP
UniProt ID: (Human) Q9NQ93
Entrez Gene ID: (Human) 29974
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.