Novus Biologicals
Manufacturer Code:NBP214321
Catalog # NBP214321
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLK DMMLYCKFKGQECGHQDFTTVFTKY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: acid sensing (proton gated) ion channel 2; acid sensing ion channel 2; acid-sensing (proton-gated) ion channel 2; Acid-sensing ion channel 2; Acid-sensing ion channel 2 Amiloride-sensitive brain sodium channel amiloride-sensitive cation channel 1 neuronal ASIC2a ASIC2Mammalian degenerin homolog BNAC1 BNaC1ACCN BNC1Amiloride-sensitive cation channel neuronal 1 degenerin hBNaC1 MDEGBrain sodium channel 1 neuronal amiloride-sensitive cation channel 1; Amiloride-sensitive brain sodium channel; Amiloride-sensitive cation channel 1, neuronal; Amiloride-sensitive cation channel neuronal 1; ASIC2; BNC1; Brain sodium channel 1; Mammalian degenerin homolog; MDEG; neuronal amiloride-sensitive cation channel 1
Gene Aliases: ACCN; ACCN1; ASIC2; ASIC2a; BNAC1; BNC1; hBNaC1; MDEG
UniProt ID: (Human) Q16515
Entrez Gene ID: (Human) 40
Molecular Function: ion channel transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.