Novus Biologicals
Manufacturer Code:NBP238648
Catalog # NBP238648
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACBP; acyl coenzyme A binding protein; Acyl-CoA-binding protein; acyl-Coenzyme A binding domain containing 1; acyl-Coenzyme A binding domain containing 1 acyl-Coenzyme A bindingprotein) CCK-RP cholecystokinin-releasing peptide trypsin-sensitive diazepam binding inhibitor (GABA receptor modulator acyl-CoA binding protein) Diazepam-binding inhibitor endozepine EP GABA receptor modulator MGC70414; cholecystokinin-releasing peptide, trypsin-sensitive; DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); Diazepam-binding inhibitor; Endozepine; EP; GABA receptor modulator
Gene Aliases: ACBD1; ACBP; CCK-RP; DBI; EP
UniProt ID: (Human) P07108
Entrez Gene ID: (Human) 1622
Molecular Function:
enzyme modulator
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.