Novus Biologicals
Manufacturer Code:NBP154936
Catalog # NBP154936
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACADL(acyl-Coenzyme A dehydrogenase long chain) The peptide sequence was selected from the N terminal of ACADL. Peptide sequence MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACAD4 acyl-CoA dehydrogenase long chain acyl-Coenzyme A dehydrogenase long chain EC 1.3.99 EC 1.3.99.13 LCADFLJ94052 long-chain specific acyl-CoA dehydrogenase mitochondrial; acyl-Coenzyme A dehydrogenase, long chain; LCAD; Long-chain specific acyl-CoA dehydrogenase, mitochondrial
Gene Aliases: ACAD4; ACADL; LCAD
UniProt ID: (Human) P28330
Entrez Gene ID: (Human) 33
Molecular Function: dehydrogenase oxidase oxidoreductase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.