Novus Biologicals
Manufacturer Code:NBP256718
Catalog # NBP256718
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACAD-9; ACAD-9 acyl-CoA dehydrogenase family member 9 mitochondrial acyl-CoA dehydrogenase family member 9 acyl-Coenzyme A dehydrogenase family member 9 EC 1.3.99 EC 1.3.99.- EC 1.3.99.10 FLJ23533 MGC14452 NPD002; Acyl-CoA dehydrogenase family member 9; acyl-CoA dehydrogenase family, member 9; acyl-Coenzyme A dehydrogenase family, member 9; Complex I assembly factor ACAD9, mitochondrial; very-long-chain acyl-CoA dehydrogenase VLCAD
Gene Aliases: ACAD9; NPD002
UniProt ID: (Human) Q9H845
Entrez Gene ID: (Human) 28976
Molecular Function:
dehydrogenase
oxidase
oxidoreductase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.