Novus Biologicals
Manufacturer Code:NBP155156
Catalog # NBP155156
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA acyltransferase; Acetyl-CoA acyltransferase acetyl-CoA acyltransferase 1 EC 2.3.1 peroxisomal; Acetyl-CoA C-myristoyltransferase; acetyl-Coenzyme A acyltransferase 1; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; peroxisomal 3-oxoacyl-Coenzyme A thiolase; testicular tissue protein Li 197
Gene Aliases: ACAA; ACAA1; PTHIO; THIO
UniProt ID: (Human) P09110
Entrez Gene ID: (Human) 30
Molecular Function:
acetyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.