Novus Biologicals
Manufacturer Code:NBP189068
Catalog # NBP189068
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABP amiloride binding protein 1 (amine oxidase (copper-containing)) Amiloride-binding protein amiloride-sensitive amine oxidase amiloride-sensitive amine oxidase [copper-containing] AOC1DAOamiloride-binding protein-1 DAO1 Diamine oxidase EC 1.4.3 EC 1.4.3.22 Histaminase KAO Kidney amine oxidase; amiloride binding protein 1 (amine oxidase (copper-containing)); Amiloride-binding protein 1; amiloride-sensitive amine oxidase; Amiloride-sensitive amine oxidase [copper-containing]; Amine oxidase copper domain-containing protein 1; DAO; diamine oxidase; Histaminase; KAO; Kidney amine oxidase
Gene Aliases: ABP; ABP1; AOC1; DAO; DAO1; KAO
UniProt ID: (Human) P19801
Entrez Gene ID: (Human) 26
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.