Novus Biologicals
Manufacturer Code:NBP159479
Catalog # NBP159479
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected from the C terminal of ABHD13. Peptide sequence LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: abhydrolase domain containing 13 abhydrolase domain-containing protein 13 bA153I24.2 BEM46L1 C13orf6 chromosome 13 open reading frame 6 EC 3.- FLJ14906 MGC27058 RP11-153I24.2; Abhydrolase domain-containing protein 13; Alpha/beta hydrolase domain-containing protein 13; Protein ABHD13
Gene Aliases: ABHD13; bA153I24.2; BEM46L1; C13orf6
UniProt ID: (Human) Q7L211
Entrez Gene ID: (Human) 84945
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.