Novus Biologicals
Manufacturer Code:NBP233574
Catalog # NBP233574
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: abhydrolase domain containing 11 abhydrolase domain-containing protein 11 EC 3.- PP1226 WBSCR21 Williams Beuren syndrome chromosome region 21 Williams-Beuren syndrome chromosomal region 21 protein; Abhydrolase domain-containing protein 11; Alpha/beta hydrolase domain-containing protein 11; Protein ABHD11; Williams Beuren syndrome chromosome region 21; Williams-Beuren syndrome chromosomal region 21 protein
Gene Aliases: ABHD11; PP1226; WBSCR21
UniProt ID: (Human) Q8NFV4
Entrez Gene ID: (Human) 83451
Molecular Function:
hydrolase
protease
serine protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.