Novus Biologicals
Manufacturer Code:NBP232679
Catalog # NBP232679
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHRMREKADIQLLVYTIDDL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: abhydrolase domain containing 10 EC 3.4 FLJ11342 mitochondrial; Abhydrolase domain-containing protein 10; abhydrolase domain-containing protein 10, mitochondrial; Acyl-protein thioesterase ABHD10; Alpha/beta hydrolase domain-containing protein 10; alpha/beta hydrolase domain-containing protein 10, mitochondrial; Mycophenolic acid acyl-glucuronide esterase, mitochondrial; Palmitoyl-protein thioesterase ABHD10, mitochondrial
Gene Aliases: ABHD10
UniProt ID: (Human) Q9NUJ1
Entrez Gene ID: (Human) 55347
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.