Novus Biologicals
Manufacturer Code:NBP15692120UL
Catalog # NBP1801720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALKBH2(alkB alkylation repair homolog 2 (E. coli)) The peptide sequence was selected from the middle region of ABH2 (NP_001001655). Peptide sequence VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2OG-Fe(II) oxy DC1; 2OG-Fe(II) oxy DC1 ABH2FLJ99103 alkB alkylation repair homolog 2 (E. coli) Alkylated DNA repair protein alkB homolog 2 alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 EC 1.14.11.- MGC90512 Oxy DC1; alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase; alkB, alkylation repair homolog 2; Alkylated DNA repair protein alkB homolog 2; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2; DNA oxidative demethylase ALKBH2; Oxy DC1
Gene Aliases: ABH2; ALKBH2
UniProt ID: (Human) Q6NS38
Entrez Gene ID: (Human) 121642
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.