Novus Biologicals
Manufacturer Code:NBP214283
Catalog # NBP214283
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDIS TEGFCHLDDQNSEVKRARIN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABH1 ABHalkB alkylation repair homolog (E. coli) alkB alkB alkylation repair homolog 1 (E. coli) ALKBH alkylated DNA repair protein alkB homolog 1 alkylation repair alkB homolog Alpha-ketoglutarate-dependent dioxygenase ABH1 DNA lyase ABH1 EC 1.14.11.- EC 4.2.99.18 hABH; alkB, alkylation repair homolog 1; Alkylated DNA repair protein alkB homolog 1; alkylation repair, alkB homolog; Alpha-ketoglutarate-dependent dioxygenase ABH1; DNA 6mA demethylase; DNA lyase ABH1; DNA N6-methyl adenine demethylase; DNA N6-methyl adenine demethylase ALKBH1; DNA oxidative demethylase ALKBH1; mRNA N(3)-methylcytidine demethylase; Nucleic acid dioxygenase ALKBH1
Gene Aliases: ABH; ABH1; alkB; ALKBH; ALKBH1; hABH
UniProt ID: (Human) Q13686
Entrez Gene ID: (Human) 8846
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.