Novus Biologicals
Manufacturer Code:NBP15938120UL
Catalog # NBP1593820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ABCF3(ATP-binding cassette sub-family F (GCN20) member 3) The peptide sequence was selected from the N terminal of ABCF3. Peptide sequence DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-binding cassette sub-family F member 3; ATP-binding cassette sub-family F member 3 ATP-binding cassette sub-family F (GCN20) member 3 EC 3.6.3 EC 3.6.3.17 EST201864 FLJ11198; ATP-binding cassette, sub-family F (GCN20), member 3
Gene Aliases: ABCF3; EST201864
UniProt ID: (Human) Q9NUQ8
Entrez Gene ID: (Human) 55324
Molecular Function:
ATP-binding cassette (ABC) transporter
RNA binding protein
hydrolase
nucleic acid binding
translation elongation factor
translation factor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.