Novus Biologicals
Manufacturer Code:NBP159808
Catalog # NBP159808
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ABCD2(ATP-binding cassette sub-family D (ALD) member 2) The peptide sequence was selected from the middle region of ABCD2. Peptide sequence WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adrenoleukodystrophy-like 1; Adrenoleukodystrophy-like 1 Adrenoleukodystrophy-related protein ALD1 ALDL1ATP-binding cassette sub-family D member 2 ALDRhALDR ALDRPABC39 ATP-binding cassette sub-family D (ALD) member 2; Adrenoleukodystrophy-related protein; ATP-binding cassette sub-family D member 2; ATP-binding cassette, sub-family D (ALD), member 2; hALDR
Gene Aliases: ABC39; ABCD2; ALD1; ALDL1; ALDR; ALDRP; hALDR
UniProt ID: (Human) Q9UBJ2
Entrez Gene ID: (Human) 225
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.