Novus Biologicals
Manufacturer Code:NBP16906320UL
Catalog # NBP16906320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Abcc12 (ATP-binding cassette sub-family C (CFTR/MRP) member 12) The peptide sequence was selected from the middle region of Abcc12. Peptide sequence NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-binding cassette sub-family C member 12; ATP-binding cassette transporter sub-family C member 12; ATP-binding cassette transporter sub-family C member 12 ATP-binding cassette sub-family C (CFTR/MRP) member 12 MGC27071 MRP9ATP-binding cassette sub-family C member 12 multidrug resistance-associated protein 9; ATP-binding cassette, sub-family C (CFTR/MRP), member 12; Multidrug resistance-associated protein 9
Gene Aliases: ABCC12; MRP9
UniProt ID: (Human) Q96J65
Entrez Gene ID: (Human) 94160
Molecular Function: ATP-binding cassette (ABC) transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.