Novus Biologicals
Manufacturer Code:NBP182623
Catalog # NBP182623
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-binding cassette protein C11; ATP-binding cassette protein C11 ATP-binding cassette transporter MRP8 ATP-binding cassette transporter sub-family C member 11 ATP-binding cassette sub-family C (CFTR/MRP) member 11 EWWD MRP8ATP-binding cassette sub-family C member 11 Multidrug resistance-associated protein 8 multi-resistance protein 8 WW; ATP-binding cassette sub-family C member 11; ATP-binding cassette transporter MRP8; ATP-binding cassette transporter sub-family C member 11; ATP-binding cassette, sub-family C (CFTR/MRP), member 11; multi-resistance protein 8; Multidrug resistance-associated protein 8
Gene Aliases: ABCC11; EWWD; MRP8; WW
UniProt ID: (Human) Q96J66
Entrez Gene ID: (Human) 85320
Molecular Function:
ATP-binding cassette (ABC) transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.