Novus Biologicals
Manufacturer Code:NBP255166
Catalog # NBP255166
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABC transporter 9 protein; ABC transporter 9 protein ATP-binding cassette sub-family B member 9 ATP-binding cassette transporter 9 ATP-binding cassette sub-family B (MDR/TAP) member 9 EC 3.6.3 EC 3.6.3.44 EST122234 hABCB9 KIAA1520 TAPL TAP-like protein; ATP-binding cassette sub-family B member 9; ATP-binding cassette transporter 9; ATP-binding cassette, sub-family B (MDR/TAP), member 9; TAP-like protein; TAPL
Gene Aliases: ABCB9; EST122234; KIAA1520; TAPL
UniProt ID: (Human) Q5W9G7
Entrez Gene ID: (Human) 23457
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.