Novus Biologicals
Manufacturer Code:NBP189311
Catalog # NBP189311
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
For Research Use Only
Protein Aliases: ABCB5 P-gp; ATP-binding cassette protein; ATP-binding cassette sub-family B member 5; ATP-binding cassette, sub-family B (MDR/TAP), member 5; P-glycoprotein ABCB5
Gene Aliases: ABCB5; ABCB5alpha; ABCB5beta; EST422562
UniProt ID: (Human) Q2M3G0
Entrez Gene ID: (Human) 340273
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.