Novus Biologicals
Manufacturer Code:NBP255403
Catalog # NBP255403
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 6-phosphofructo-2-kinase; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3; 6PF-2-K/Fru-2,6-P2ase 3; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; 6PF-2-K/Fru-26-P2ase 36-bisphosphatase 6-phosphofructo-2-kinase/ fructose-26-bisphosphatase 6-phosphofructo-2-kinase/fructose-26-biphosphatase 36-phosphofructo-2-kinase/fructose-26-bisphosphatase FLJ37326 inducible 6-phosphofructo-2-kinase/fructose-26-bisphosphatase IPFK2 Renal carcinoma antigen NY-REN-56; Fructose-2,6-bisphosphatase; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; iPFK-2; PFK/FBPase 3; Renal carcinoma antigen NY-REN-56
Gene Aliases: iPFK-2; IPFK2; PFK2; PFKFB3
UniProt ID: (Human) Q16875
Entrez Gene ID: (Human) 5209
Molecular Function:
carbohydrate phosphatase
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.