Novus Biologicals
Manufacturer Code:NBP155429
Catalog # NBP155429
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5-HT 2B receptor; 5-HT(2B) 5-HT-2B 5-HT2B5-HT 2B receptor 5-hydroxytryptamine (serotonin) receptor 2B 5-hydroxytryptamine 2B receptor 5-hydroxytryptamine receptor 2B Serotonin receptor 2B; 5-HT-2B; 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled; 5-hydroxytryptamine 2B receptor; 5-hydroxytryptamine receptor 2B; 5-hydroxytryptamine receptor 2B variant b; Serotonin receptor 2B
Gene Aliases: 5-HT(2B); 5-HT-2B; 5-HT2B; HTR2B
UniProt ID: (Human) P41595
Entrez Gene ID: (Human) 3357
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.