Novus Biologicals
Manufacturer Code:NBP19825520UL
Catalog # NBP19825520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is 4930567H17Rik. Peptide sequence TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4930567H17Rik RIKEN cDNA 4930567H17 gene; uncharacterized protein LOC619303
Entrez Gene ID: (Mouse) 619303
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.