Novus Biologicals
Manufacturer Code:NBP184901
Catalog # NBP184901
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 17-beta-HSD 1; 17-beta-HSD 1 17-beta-hydroxysteroid dehydrogenase type 1 20 alpha-hydroxysteroid dehydrogenase 20-alpha-HSD E17KSR E2DH EC 1.1.1.62 EDH17B1 EDH17B2EDHB17 estradiol 17-beta-dehydrogenase 1 estradiol 17-beta-dehydrogenase-1 HSD17 hydroxysteroid (17-beta) dehydrogenase 1 hydroxysteroid (17-beta) dehydrogenase 1 isoform MGC138140 Placental 17-beta-hydroxysteroid dehydrogenase SDR28C1 short chain dehydrogenase/reductase family 28CE member 1; 17-beta-hydroxysteroid dehydrogenase type 1; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E2DH; Estradiol 17-beta-dehydrogenase 1; estradiol 17-beta-dehydrogenase-1; hydroxysteroid (17-beta) dehydrogenase 1 isoform; Placental 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 28C member 1; short chain dehydrogenase/reductase family 28CE, member 1
Gene Aliases: E17KSR; EDH17B1; EDH17B2; EDHB17; HSD17; HSD17B1; SDR28C1
UniProt ID: (Human) P14061
Entrez Gene ID: (Human) 3292
Molecular Function: dehydrogenase oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.