Novus Biologicals
Manufacturer Code:NBP187061
Catalog # NBP187061
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; 15-hydroxyprostaglandin dehydrogenase [NAD+] 15-PGDH EC 1.1.1 EC 1.1.1.141 hydroxyprostaglandin dehydrogenase 15-(NAD) NAD+-dependent 15-hydroxyprostaglandin dehydrogenase PGDH1PGDH Prostaglandin dehydrogenase 1 SDR36C1 short chain dehydrogenase/reductase family 36C member 1; 15-PGDH; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; Prostaglandin dehydrogenase 1; Short chain dehydrogenase/reductase family 36C member 1; short chain dehydrogenase/reductase family 36C, member 1
Gene Aliases: 15-PGDH; HPGD; PGDH; PGDH1; PHOAR1; SDR36C1
UniProt ID: (Human) P15428
Entrez Gene ID: (Human) 3248
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.