Novus Biologicals
Manufacturer Code:NBP15514520UL
Catalog # NBP15514520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALOX15B(arachidonate 15-lipoxygenase type B) The peptide sequence was selected from the N terminal of ALOX15B (NP_001034220) Peptide sequence MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 15-lipoxygenase 2; 15-lipoxygenase 2 15-LOX-B arachidonate 15-lipoxygenase 2 arachidonate 15-lipoxygenase B Arachidonate 15-lipoxygenase type II arachidonate 15-lipoxygenase second type arachidonate 15-lipoxygenase type B arachidonate omega(6) lipoxygenase EC 1.13.11 EC 1.13.11.3315-LOX-215S-lipoxygenase; 15-LOX-2; 15-LOX-B; 15S-lipoxygenase; arachidonate 15-lipoxygenase 2; Arachidonate 15-lipoxygenase B; Arachidonate 15-lipoxygenase type II; arachidonate 15-lipoxygenase, second type; arachidonate omega(6) lipoxygenase; Linoleate 13-lipoxygenase 15-LOb; Polyunsaturated fatty acid lipoxygenase ALOX15B
Gene Aliases: 15-LOX-2; ALOX15B
UniProt ID: (Human) O15296
Entrez Gene ID: (Human) 247
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.