Novus Biologicals
Manufacturer Code:NBP189827
Catalog # NBP189827
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 14-3-3 epsilon; 14-3-3 epsilon 14-3-3 protein epsilon FLJ45465 FLJ5355914-3-3E KCIP-1 MDCR MDS mitochondrial import stimulation factor L subunit protein kinase C inhibitor protein-1 tyrosine 3/tryptophan 5 -monooxygenase activation protein epsilon polypeptide tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilonpolypeptide; 14-3-3 protein epsilon; 14-3-3E; epididymis luminal protein 2; mitochondrial import stimulation factor L subunit; protein kinase C inhibitor protein-1; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
Gene Aliases: 14-3-3E; HEL2; KCIP-1; MDCR; MDS; YWHAE
UniProt ID: (Human) P62258
Entrez Gene ID: (Human) 7531
Molecular Function:
chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.