Novus Biologicals
Manufacturer Code:NBP180611
Catalog # NBP180611
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 14-3-3 alpha; 14-3-3 alpha 14-3-3 beta 14-3-3 protein beta/alpha brain protein 14-3-3 beta isoform GW128 HS1 KCIP-1 Protein 1054 Protein kinase C inhibitor protein 1 protein kinase C inhibitor protein-1 tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein alphapolypeptide tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein betapolypeptide YWHAA; 14-3-3 protein beta/alpha; 14-3-3 protein beta/alpha, N-terminally processed; brain protein 14-3-3, beta isoform; epididymis secretory protein Li 1; KCIP-1; Protein 1054; Protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
Gene Aliases: GW128; HEL-S-1; HS1; KCIP-1; YWHAA; YWHAB
UniProt ID: (Human) P31946
Entrez Gene ID: (Human) 7529
Molecular Function: chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.