Novus Biologicals
Manufacturer Code:NBP156327
Catalog # NBP156327
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALOX12(arachidonate 12-lipoxygenase) The peptide sequence was selected from the C terminal of ALOX12. Peptide sequence MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 12(S)-lipoxygenase; 12(S)-lipoxygenase 12-LOX 12S-lipoxygenase 12S-LOXarachidonate 12-lipoxygenase 12S-type arachidonate 12-lipoxygenase EC 1.13.11 EC 1.13.11.31 LOG12 platelet 12-LOX platelet-type 12-lipoxygenase Platelet-type lipoxygenase 12; 12S-lipoxygenase; 12S-LOX; Arachidonate (12S)-lipoxygenase; Arachidonate (15S)-lipoxygenase; arachidonate 12-lipoxygenase; Linoleate (13S)-lipoxygenase; Lipoxin synthase 12-LO; platelet 12-LOX; platelet-type 12-lipoxygenase; Platelet-type lipoxygenase 12; Polyunsaturated fatty acid lipoxygenase ALOX12
Gene Aliases: 12-LOX; 12LO; 12S-LOX; ALOX12; LOG12
UniProt ID: (Human) P18054
Entrez Gene ID: (Human) 239
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.