Novus Biologicals
Manufacturer Code:NBP169644
Catalog # NBP169644
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to 11 Beta HSD1(hydroxysteroid (11-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of 11 Beta HSD1. Peptide sequence QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 11-beta-hydroxysteroid dehydrogenase 1; 11-beta-hydroxysteroid dehydrogenase 1 EC 1.1.1 EC 1.1.1.146 HDL HSD11HSD11B HSD11LMGC13539 hydroxysteroid (11-beta) dehydrogenase 1 member 1 SDR26C1; 11-DH; Corticosteroid 11-beta-dehydrogenase isozyme 1; hydroxysteroid (11-beta) dehydrogenase 1; Short chain dehydrogenase/reductase family 26C member 1; short chain dehydrogenase/reductase family 26C, member 1
Gene Aliases: 11-beta-HSD1; 11-DH; CORTRD2; HDL; HSD11; HSD11B; HSD11B1; HSD11L; SDR26C1
UniProt ID: (Human) P28845
Entrez Gene ID: (Human) 3290
Molecular Function: dehydrogenase oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.