Novus Biologicals
Manufacturer Code:NBP238879
Catalog # NBP238879
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: IASPPinhibitor of apoptosis stimulating protein of p53 Inhibitor of ASPP protein NFkB-interacting protein 1 NKIP1 PPP1R13BL PPP1R13B-like protein Protein iASPP protein phosphatase 1 regulatory (inhibitor) subunit 13 like protein phosphatase 1 regulatory subunit 13 like RAINFkB interacting protein 1 relA-associated inhibitor; inhibitor of apoptosis stimulating protein of p53; Inhibitor of ASPP protein; NFkB interacting protein 1; NFkB-interacting protein 1; PPP1R13B-like protein; Protein iASPP; protein phosphatase 1, regulatory (inhibitor) subunit 13 like; protein phosphatase 1, regulatory subunit 13 like; RelA-associated inhibitor; retinoic acid induced 4
Gene Aliases: IASPP; NKIP1; PPP1R13BL; PPP1R13L; RAI; RAI4
UniProt ID: (Human) Q8WUF5
Entrez Gene ID: (Human) 10848
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.